logo

De nieuwste gratis producten en spullen

gratis product Gratis informatie Zonnepanelen (zonder investering vooraf)
geld verdienen
Ontdek hoe je zonder investering vooraf jouw dak kunt voorzien van A-klasse zonnepalen. Vraag vrijblijvend meer informatie aan om € 960,- per jaar te besparen.
privacy
 
 
gratis product Maak kans op Elektrische Fiets t.w.v. € 1.699,- (2x)
winnen
Vergelijk 30 Nederlandse energieleveranciers en maak kans op één van de twee elektrische fietsen t.w.v. € 1.699,- (dames of heren).
privacy
 
 
gratis product Onbeperkt 4G-Internet & Bellen & SMS voor maar € 25,- p/m bij Tele2
korting
Vanaf vandaag start Tele2 met onbeperkt supersnel 4G-internet & bellen & sms'en, voor maar € 25,- per maand! (ook in combinatie met een toestel) Bij zowel smartphone als een sim only abonnement heb je de keus om voor maandelijks opzegbaar te kiezen. Tele2 is uitgeroepen tot 'Beste mobiele provider van 2017'.
privacy
 
 
gratis product Gratis Ultima II Lipchrome Lipstick uitproberen (450x)
winnen
Probeer gratis nieuwe producten uit en verdien geld met enquetes bij het vernieuwde Toluna. Nu kunnen 450 deelnemers gratis Ultima II Lipchrome Lipstick uitproberen. Binnenkort kan je ook Tetley Green Tea Mojito (400x) uitproberen. Nadat je bent aangemeld klik je rechtsboven op 'Ontdek' en daarna op 'Testproducten'. Maandelijks maak je ook nog eens kans op 5.000,-.
privacy
 
 
gratis product Gratis Weleda Arnica Sport Douchegel t.w.v. € 2,35
gratis producten
Lever de waardebon (PDF-bestand) uiterlijk 30 juni in bij een D.I.O. Drogisterij en ontvang gratis een mini Weleda Arnica Sport Douchegel t.w.v. € 2,35. Deze douchegel zorgt voor soepele spieren na het sporten. Met frisse geur van rozemarijn en lavendel.
privacy
 
 
gratis product Geld Terug Actie: flesje Chaudfontaine Fusion 0,25L
geld terug actie
Koop bij één van de aangesloten horecazaken een 0,25L glazen flesje Chaudfontaine Fusion. Er zijn 2 varianten: Citroensmaak en Pompelmoes & Cranberry. Vul de barcode in, maak een foto van het flesje en ontvang het aankoopbedrag terug op jouw rekening. Deze actie loopt t/m 31 juli.
privacy
 
 
gratis product Maak kans op Goossens Shoptegoed t.w.v. € 400,-
winnen
Meld je aan voor de Goossens nieuwsbrief, ontvang de laatste interieurtrends en maak kans op € 400,- shoptegoed. De winnaar wordt iedere eerste van de maand bekendgemaakt.
privacy
 
 
gratis product Win 1 jaar lang Gratis Tesla Model S rijden t.w.v. € 21.000,-
winnen
Laat je éénmalig vrijblijvend informeren door Vandebron en maak automatisch kans op een jaar lang Tesla Model S rijden t.w.v. € 21.000,-. De winnaar wordt opgebeld, dus zorg voor een geldig telefoonnummer.
privacy
 
 
gratis product Gratis proefpakket Platinum Hondenvoer
gratis producten
Het gratis proefpakket van Platinum Hondenvoer bestaat uit onze drie soorten Adult voeding en een aantal Fit-Sticks Chicken+Lamb. Platinum complete voeding bestaat voor ten minste 70% uit vers vlees en ruikt en smaakt naar vlees.
privacy
 
 
gratis product Gratis Skala Kortingscheque t.w.v. € 120,-.
korting
Skala heeft een nieuwe kortingsactie. Kras alle vakjes open en ontvang een kortingscheque t.w.v. € 120,-.
privacy
 
 
gratis product Gratis Maybelline Eye Shadow Color Show (500x) uitproberen
winnen
Probeer gratis nieuwe producten uit en verdien geld met enquetes bij het vernieuwde Toluna. Nu kunnen 500 deelnemers gratis Maybelline Eye Shadow Color Show uitproberen. Binnenkort kan je ook Tetley Green Tea Mojito (400x) en Ultima II Lipchrome Lipstick (450x) uitproberen. Nadat je bent aangemeld klik je rechtsboven op 'Ontdek' en daarna op 'Testproducten'. Maandelijks maak je ook nog eens kans op 5.000,-.
privacy
 
 
gratis product Gratis Flexa Kleurtester t.w.v. € 1,99
gratis producten
Maak een account aan, log in en gebruik de code rtl om een gratis Flexa Kleurtester t.w.v. € 1,99 te bestellen (als je niet ingelogd bent, werkt de code niet). Werkt de kortingscode niet meer? Probeer het dan morgen opnieuw.
privacy
 
 
gratis product Gratis Sport High Protein Recovery Bar
gratis producten
De Vifit Sport High Protein Recovery Bar geeft je spieren ondersteuning na het sporten. Probeer gratis een van de 3 smaken: Lemon Yoghurt, Cranberry & Peach Yoghurt. Update 9 mei: Vanwege de vele sample aanvragen zijn ze tijdelijk door de sample voorraad heen. Er gaat nog een tweede ronde komen.
privacy
 
 
gratis product Gratis reep Crispy Cookie Caramel & Sea Salt (Hands Off Chocolade)
geld terug actie
Als je in 2017 nog niet hebt meegedaan aan een actie van Handsoff Chocolade dan kan je met deze nieuwe actie meedoen: Gratis reep Crispy Cookie Caramel & Sea Salt. Bekijk de instructies om mee te doen (verkrijgbaar bij Albert Heijn, Jumbo, Marqt, Deen, Spar en Jan Linders).
privacy
 
 
gratis product Gratis waarde van je auto berekenen
gratis producten
Nieuwsgierig wat jouw auto waard is? Vul jouw kenteken en KM-stand in op de website. Je ziet dan direct de waarde van jouw auto.
privacy
 
 
gratis product Gratis proefverpakking Gourmet Mon Petit Kattenvoer
gratis producten
Vraag een gratis proefverpakking van Gourmet Mon Petit Kattenvoer aan (1 x 50 gram zakjes). Ze proberen de proefverpakking binnen 2 weken toe te sturen.
privacy
 
 
gratis product Gratis Primera Spaarpas + Verschillende Cadeautjes
gratis producten
Met de gratis Primera Spaarpas spaar je Primera punten over je aankopen (verkrijgbaar in de winkel). Je spaart voor een gratis 1/5 Staatslot of de helft in contanten. Gedurende 1 jaar tijd dat wij nu lid zijn hebben wij per e-mail waardebonnen gekregen voor: gratis winkelmagenmuntje, chocolade letter, kerstkaarten, tas, Autoweek special en punten op de verjaardag.
privacy
 
 
gratis product Gratis probeerpakket Depend (met 2 of 3 producten)
gratis producten
De producten van Depend helpen beschermen bij urineverlies. Je kan kiezen uit 3 verschillende probeerpakketten: Licht, Matig en Zwaar. Hierin zitten twee of drie verschillende producten (inlegkruisjes, verband en pants). Het pakket wordt de eerstvolgende werkdag in een discrete probeerverpakking naar je opgestuurd. Deze actie is voor mannen en vrouwen.
privacy
 
 
gratis product Maak kans op een 2-daagse Brouwcursus
winnen
Geef je op om kans te maken op een 2-daagse brouwcursus bij een van de deelnemende speciaalbierbrouwerijen. Je krijgt dan een rondleiding door de brouwerij, leer je alles over smaken, geuren en kleuren, hoe je bier brouwt én wat er mis kan gaan. Ook mag je proeven en ga je zelf aan de slag.
privacy
 
 
gratis product Gratis Huismerkproducten bij Plus Klantenpanel
gratis producten
Winkel je wel eens bij de Plus Supermarkt? Dan is het Plus Klantenpanel misschien wel iets voor jou. Er zijn 4-5 onderzoeken per jaar. De beloning is een huismerkproduct of kans op Plus cadeaukaarten.
privacy
 
 
gratis product Gratis Mentos Rainbow (350x) uitproberen
winnen
Probeer gratis nieuwe producten uit en verdien geld met enquetes bij het vernieuwde Toluna. Nu kunnen 350 deelnemers gratis Mentos Rainbow uitproberen. Binnenkort kan je ook Maybelline Eye Shadow Color Show (500x) en Ultima II Lipchrome Lipstick (450x) uitproberen. Nadat je bent aangemeld klik je rechtsboven op 'Ontdek' en daarna op 'Testproducten'. Maandelijks maak je ook nog eens kans op 5.000,-.
privacy
 
 
gratis product Gratis zakje Zonnebloem- en/of Pompoenzaden
gratis producten
RTV Rijnmond is op zoek naar de ZonnebloemKampioen en de PompoenKampioen van de regio Rotterdam. Als je in deze regio woont kan je per mail een zakje wedstrijdzaden aanvragen. Alleen met die zaden maak je kans op de kampioenstitel en de prachtige hoofdprijs.
privacy
 
 
gratis product Gratis Tonijnwrap
gratis producten
John West toert deze zomer door Nederland. Check of ze bij een locaties bij jou in de buurt komen. Je kan dan gratis een tonijnwrap proeven. Deze wordt vers bereid met rucola, wasabi mayonnaise en tonijn van John West.
privacy
 
 
gratis product Gratis proefnummer OKIDO t.w.v. € 3,99
gratis producten
Benieuwd naar het spiksplinternieuwe eerste nummer van OKIDO tijdschrift? Stuur dan een mailtje naar info@okidotijdschrift.nl met jouw naam en adres. Het tijdschrift komt dan zo snel mogelijk jouw kant op. Doelgroep: Kinderen tussen de 3 en 6 jaar.
privacy
 
 
gratis product Gratis 3 Tibetaanse Vrijheidsarmbandjes 'Rangzen'
gratis producten
Teken de petitie om Panchen Lama vrij te laten. Hij is al 6-jarige ontvoerd door China en wordt inmiddels al 22 jaar gevangen gehouden. Na het versturen van het formulier kan je gratis Tibetaanse Vrijheidsarmbandjes 'Rangzen' aanvragen (maximaal 3 stuks).
privacy
 
 
Pagina 3 van 19   1  2  3  4  5  6  7  8  9  10  volgende >
    VEELGESTELDE VRAGENSTUUR EEN TIP INCONTACT
    COPYRIGHT © 2000 - 2017 • SITEMAPRSSLINKSPRIVACYDISCLAIMER

    rss bestand