logo

Gratis

gratis product Gratis nummer Radar+ Magazine
gratis producten
Vergelijk vrijblijvend 23 energieaanbieders van Nederland met elkaar en ontvang sowieso een gratis e-nummer van Radar+.
privacy
 
 
gratis product Gratis Bicycling Magazine t.w.v. € 5,95
gratis producten
Ontvang gratis het Bicycling Magazine t.w.v. € 5,95 (nr 1 2018). In dit magazine wordt de mens op de fiets centraal gesteld. Met bijzondere verhalen van gewone mensen en ongewone verhalen van bijzondere mensen.
privacy
 
 
gratis product Gratis Sport High Protein Recovery Bar
gratis producten
Weer beschikbaar! De Vifit Sport High Protein Recovery Bar geeft je spieren ondersteuning na het sporten. Probeer gratis een van de 3 smaken: Lemon Yoghurt, Cranberry & Peach Yoghurt. Mededeling: Ververs de pagina of probeer een andere browser als er staat dat de samples op zijn. Eventueel kan je de volgende link kopiëren en plakken: https://www.vifitsport.com/nl/probeer-gratis/aanvragen
privacy
 
 
gratis product Gratis proefverpakking Nikwax BaseWash
gratis producten
Nikwax BaseWash reinigt effectief en verwijdert bacteriën en transpiratie uit de synthetische base layers. Beantwoord 5 vragen en ontvang een gratis proefverpakking met 50ml geconcentreerd Nikwax BaseWash. Je mag zo vaak meedoen als je wilt (hoewel je slechts 1x per 2 maanden een gratis product kan winnen).
privacy
 
 
gratis product Gratis Spreekbeurtpakket KNRM
gratis producten
Iedereen die een spreekbeurt wilt houden over de Koninklijke Nederlandse Redding Maatschappij kan een gratis spreekbeurtpakket aanvragen. Dit pakket bevat prachtige posters en het boekje "Redders op woest water".
privacy
 
 
gratis product Gratis PC Game Dead Space
gratis producten
Bij Origin kan je nu tijdelijk Dead Space voor PC downloaden. In deze actie/shooter speel jij Isaac Clarke, een ingenieur op het ruimteschip USG Ishimura. Het is niet bekend hoe lang de actie duurt. Klik op 'toevoegen aan gamebibliotheek'.
privacy
 
 
gratis product Gratis L'Oréal Paris Elvive Fijne Kokosolie 2-in-1 Haarmasker
gratis producten
Weer beschikbaar: Vraag via Facebook een gratis sample aan van het nieuwe L'Oréal Paris Elvive Fijne Kokosolie 2-in-1 Haarmasker (voor onder de douche). Dit haarmasker zorgt voor intensieve voeding en makkelijke ontwarring, zonder te verzwaren.
privacy
 
 
gratis product Gratis magazine Roompot Vakanties
gratis producten
Het gloednieuwe magazine van Roompot Vakanties is uit. Naast leuke vakantiebestemmingen ook ervaringen van gasten, reportages en allerlei tips en ideeën voor zowel jezelf als voor de kids. Alleen inschrijven voor de nieuwsbrief kan ook. Je ontvangt dan de beste aanbiedingen en last minutes.
privacy
 
 
gratis product Gratis € 7,50 PayPal voor korting bij iBood
gratis producten
Bij PayPal ontvang je 7,50 die je kunt besteden bij iBood. Met dat tegoed kan je een gratis Simson Bandenplakset t.w.v. 6,95 bestellen (inclusief verzending). Kies bij betaalmethode voor PayPal om het gratis tegoed te gebruiken. Je kan het tegoed ook als korting voor een van de vele andere producten gebruiken.
privacy
 
 
gratis product Gratis 2 HEMA Tompouces
gratis producten
Tag op Facebook iemand met wie je graag een tompouce wilt eten en vul het formulier in om op 1 maart een voucher van KNAB te ontvangen. Met deze voucher kan je 2 gratis tompouces ophalen bij HEMA (tot 18 maart). Het aantal vouchers heeft een limiet, dus op=op. Tip: Mocht je op je mobiel geen venster krijgen om je gegevens in te vullen, gebruik dan een pc/laptop en klik op 'Registreren'.
privacy
 
 
gratis product Gratis 10 nummers FiscAlert (met handige info over Belastingaangifte)
gratis producten
Vanaf 1 maart 2018 moet je weer de belastingaangifte doen over 2017. Ontvang 10 nummers van FiscAlert (met zeer handige tips en informatie over bijvoorbeeld de Belastingaangifte, Prinsjesdag, hypotheken, pensioen, sparen, beleggen, Bitcoins, etc.). Het mooie is dat je na afloop zelf bepaalt wat jou de 10 nummers waard zijn geweest, na afloop ontvang je namelijk een blanco acceptgiro.
privacy
 
 
gratis product Gratis sample A. Vogel Keeltabletten
gratis producten
Vraag een gratis sample aan van A. Vogel Keeltabletten. Deze suikervrije zuigtabletten verzachten de keel en stimuleren het immuunsysteem. Mededeling: Als je 00000 ziet staan, tik of klik in de adresbalk op het internetadres en druk op 'enter' (of probeer een andere browser/computer).
privacy
 
 
gratis product Gratis Daten bij HappyPancake (nr 1 in Zweden en Finland!)
gratis producten
HappyPancake is nu ook beschikbaar in Nederland! Dit is de best bezochte gratis datingsite in Zweden en Finland. 100% gratis zonder verborgen kosten. Er is een speciaal team dat alle profielen op echtheid controleert.
privacy
 
 
gratis product Gratis Feyenoord Kameraadjes-lidmaatschap (o.a. Welkomstpakket, Bezoek wedstrijd, Magazine, Rondleiding door De Kuip en meer)
gratis producten
Op woensdag 14 februari is het precies negen maanden na 14 mei 2017, de dag dat Feyenoord kampioen van Nederland werd. Dit zou zomaar kunnen leiden tot een geboortegolf van Kampioensbaby's :) Baby's geboren op 14 februari 2018 krijgen een gratis Kameraadjes-lidmaatschap voor de volledige looptijd van veertien jaar. Baby's die zijn geboren tussen 7 februari 2018 en 21 februari 2018 (met uitzondering van 14 februari 2018) krijgen tot het einde van seizoen 2017-2018 het Kameraadjes-lidmaatschap gratis.
privacy
 
 
gratis product Gratis Evenement: Landelijke Sterrenkijkdagen
gratis producten
Op 23, 24 en 25 februari zijn het de Landelijke Sterrenkijkdagen. Overal in het land vinden activiteiten plaats die de sterrenkunde dicht bij de mensen brengt. Bekijk de lijst met 'Kijkadressen' om te zien of de toegang gratis is.
privacy
 
 
gratis product Gratis 2 entreekaarten avondopening Negenmaandenbeurs / Huishoudbeurs t.w.v. € 11,50 p.s.
gratis producten
Met de Kruidvat Jouw Extravoordeelkaart kan je gratis 2 toegangskaarten aanvragen voor de avondopening van de Negenmaandenbeurs op donderdag 22 of vrijdag 23 februari tussen 17.00 en 22.00. Deze kaarten zijn ook geldig voor de huishoudbeurs. Als je nog geen Kruidvat Jouw Extravoordeelkaart hebt, kan je deze gratis ophalen bij een winkel van Kruidvat. Wil je op een andere dag gaan of overdag? Koop dan je kaarten voor de Negenmaandenbeurs met € 3,55 korting (21 t/m 25 februari) of Huishoudbeurs met € 3,55 korting (17 t/m 25 februari). Met een kaartje kan je beide beurzen bezoeken.
privacy
 
 
gratis product Gratis sample Yves Saint Laurent Touche Éclat Le Teint
gratis producten
Tegen inlevering van deze waardebon bij Douglas ontvang je een sample van Yves Saint Laurent Touche Éclat Le Teint. Er is ook nog een andere waardebon voor een gratis sample van Yves Saint Laurent Black Opium Glow, Black Opium, L'Homme of L'Homme Ultime. Inleveren kan t/m 28 februari.
privacy
 
 
gratis product Gratis Olympische Winterspelen kijken
gratis producten
Kijk jij TV via Ziggo? Volg dan de Olympische Winterspelen gratis op vijf kanalen (live bij Eurosport en onderweg via Ziggo GO). Kanalen: 20, 411, 408, 409 en 410. De NOS zendt slechts een deel van de Olympische Spelen uit.
privacy
 
 
gratis product Gratis eBooks (100+)
gratis producten
Bij Bol.com kan je gratis eBooks krijgen die je op jouw computer, tablet, mobiel of e-reader kunt lezen. Het lezen van eBooks op je tablet/mobiel kan eenvoudig met de speciale Bol.com Kobo eBook app. Het lezen op de computer kan door Adobe Digital Editions te gebruiken.
privacy
 
 
gratis product Gratis exemplaar 'Basisprincipes Beleggen'
gratis producten
Registreer jezelf gratis bij iForex en ontvang een gratis het boek 'Basisprincipes Beleggen: Leer in 60 minuten de basis van beleggen.'. Met uitleg & tips voor beleggen, populaire beleggingsstrategieën en hoe je kunt omgaan met handelssignalen. Er is ook aandacht voor de 3 meest gemaakte beleggersfouten.
privacy
 
 
gratis product Minimaal € 15,- (oplopend tot € 100.000,-) + Gratis VIP-kaart voor Gratis onbeperkt toegang tot 50 Top Musea + Korting Dagjes Uit
gratis producten
Ga (extra) meespelen in de BankGiro Loterij en ontvang een bedrag van € 100.000,-, € 10.000,-, € 1.000,-, € 500,-, 20,- of € 15,-. Kies een van de 6 cheques en ontdek direct wat je gewonnen hebt. Je ontvangt sowieso een gratis VIP-kaart (hiermee krijg je o.a. gratis onbeperkt toegang tot 50 top musea + tot 50% korting op dagjes en avondjes uit). Je speelt mee zolang je zelf wilt.
privacy
 
 
gratis product Gratis Faith Magazine + 4 Wenskaarten
gratis producten
Faith is een glossy over huwelijk, liefde en trouw. Het magazine bevat achtergrondverhalen en interviews, met onder anderen Tooske en Bastiaan Ragas van het EO-programma 'Zo zijn we niet getrouwd'. Met achtergrondverhalen over communicatiestijlen (inclusief testje), ruziepatronen, de verschillende fases van het huwelijk en wat geluk eigenlijk precies is. Er zitten ook 4 wenskaarten bij.
privacy
 
 
gratis product Bespaar € 550,- per jaar op de energierekening
gratis producten
Ontvang vrijblijvend advies over het isoleren van jouw huis. Zo bespaar je al gauw € 550,- per jaar op de energierekening. Naast een hoger wooncomfort, wordt de woning meer waard en krijg je een beter energielabel.
privacy
 
 
gratis product Gratis Receptenboek
gratis producten
Proef de smaken van Zuid-Amerika met het gratis receptenboek vol met zuid-amerikaanse gerechten. Dit receptenboek wordt aangeboden door Juconi.
privacy
 
 
gratis product Gratis rondleiding Yakult fabriek + Goodiebag
gratis producten
Yakult heeft data gereserveerd voor een rondleiding in de fabriek in Almere. Je wordt verwelkomd met koffie of thee, er is een presentatie over Yakult, proeverij met productieprocesrondleiding en een gratis goodiebag.
privacy
 
 
Pagina 1 van 15   1  2  3  4  5  6  7  8  9  10  volgende >
    VEELGESTELDE VRAGENSTUUR EEN TIP INCONTACT
    COPYRIGHT © 2000 - 2018 • SITEMAPRSSLINKSPRIVACYDISCLAIMER

    rss bestand