logo

Gratis

gratis product Gratis Lief Dier Magazine (nummer 1 - 2018)
gratis producten
Haal bij Pets Place gratis het nieuwe Lief Dier Magazine. In dit trendy magazine lees je allerlei leuke, informatieve verhalen, rubrieken, interviews en reportages die met honden, katten, konijnen, vogels, knagers en vissen te maken hebben. Ook bij online bestellingen krijg je gratis het Lief Dier Magazine.
privacy
 
 
gratis product Gratis advies Feenstra Alarmsysteem
gratis producten
Ontvang gratis en vrijblijvend advies met over de mogelijkheden van een Feenstra alarmsysteem en camerabewaking in en om jouw woning.
privacy
 
 
gratis product Gratis DVD The Passion 2018 Live in de Bijlmer
gratis producten
Vraag gratis en vrijblijvend de DVD The Passion 2018 aan (je kan ook een polsbandje kiezen). The Passion is een live evenement met BN'ers, dit jaar in de Bijlmer Amsterdam. De DVD zal medio mei thuis bij je op de mat vallen. Vond je de uitzending super? Steun dan de EO en word lid, zodat ze programma's en evenementen zoals The Passion kunnen blijven maken. Je krijgt dan ook elk jaar een gratis EO Kalender.
privacy
 
 
gratis product Gratis 3 stalen PVC Vloeren
gratis producten
Benieuwd hoe een PVC vloer er bij jou thuis uitziet? Vraag maximaal 3 gratis PVC stalen aan. Deze zijn van A4 formaat en dus groot genoeg om een realistisch beeld te geven. De stalen kan je zelf uitkiezen, de productnamen/het artikelnummer staat boven de prijs als je een vloer hebt aangeklikt.
privacy
 
 
gratis product Gratis 2 weken Dagblad van het Noorden
gratis producten
Probeer nu gratis 2 weken Dagblad van het Noorden. Je krijgt dan elke dag de krant in de bus en met de app kan je de krant ook digitaal lezen (onbeperkt PLUS-artikelen lezen). Dit proefabonnement stopt automatisch en er zijn geen verdere verplichtingen.
privacy
 
 
gratis product Gratis 2 weken Leeuwarder Courant
gratis producten
Probeer nu gratis 2 weken de Leeuwarder Courant. Je krijgt dan 6 dagen per week de krant in de bus met op zaterdag een extra dikke weekendbijlage. Met de app kan je de krant ook digitaal lezen (onbeperkt PLUS-artikelen lezen). Dit proefabonnement stopt automatisch.
privacy
 
 
gratis product Gratis New York Minimagazine
gratis producten
Bestel gratis het New York minimagazine. Hierin staat de belangrijkste informatie en praktische informatie die je nodig hebt voor een reis naar New York.
privacy
 
 
gratis product Gratis Koffie, Cappuccino of Thee bij La Place
gratis producten
In het nieuwe Hallo Jumbo Magazine (nr. 3) zit op pagina 147 een waardebon voor een gratis normale koffie, cappuccino of thee bij een La Place Restaurant (t/m 31 mei). De bon is niet geldig bij vliegvelden, treinstations, outlets en evenement locaties.
privacy
 
 
gratis product Gratis actiepakket WNF-Rangeractie Team Tijger
gratis producten
Kom in actie voor de tijger, vraag een gratis actiepakket aan. Hierin zit o.a. een poster, het magazine Ranger Report en sms-bonnen. Als je geld ophaalt voor de tijger dan krijg je een Team Tijger patch voor op je jas/tas of een tijger-sleutelhanger.
privacy
 
 
gratis product Gratis Formule 1 kijken voor Ziggo klanten
gratis producten
Klanten van Ziggo kunnen vanaf zondag weer gratis naar de Formule 1 met Max Verstappen kijken. Nog geen klant? Je hebt Ziggo Alles-in-1 nu de eerste 3 maanden voor € 39,95 en dan kijk je gratis live Formule 1 op Ziggo Sport.
privacy
 
 
gratis product Gratis 10 nummers FiscAlert (met handige info over Belastingaangifte)
gratis producten
Vanaf 1 maart 2018 moet je weer de belastingaangifte doen over 2017. Ontvang 10 nummers van FiscAlert (met zeer handige tips en informatie over bijvoorbeeld de Belastingaangifte, Prinsjesdag, hypotheken, pensioen, sparen, beleggen, Bitcoins, etc.). Het mooie is dat je na afloop zelf bepaalt wat jou de 10 nummers waard zijn geweest, na afloop ontvang je namelijk een blanco acceptgiro.
privacy
 
 
gratis product Gratis sample Elvive Dream Lengths No Haircut Cream
gratis producten
Via Facebook kan je een gratis sample aanvragen van Elvive Dream Lengths No Haircut Cream. Dit is een leave-in crème die je haar beschermt tegen haarbreuk en gespleten punten.
privacy
 
 
gratis product Gratis proefnummer Visie
gratis producten
Vraag nu gratis een proefexemplaar van Visie aan. De mediagids boordevol inspirerende artikelen en praktische informatie over radio, tv, geloof en samenleving.
privacy
 
 
gratis product Minimaal € 15,- Paasgeld (oplopend tot € 100.000,-) + Gratis VIP-kaart voor Gratis onbeperkt toegang tot 50 Top Musea + Korting Dagjes Uit
gratis producten
Ga (extra) meespelen in de BankGiro Loterij en ontvang paasgeld, een bedrag van € 100.000,-, € 10.000,-, € 1.000,-, € 500,-, 20,- of € 15,-. Kies een van de 6 cheques en ontdek direct wat je gewonnen hebt. Je ontvangt sowieso een gratis VIP-kaart (hiermee krijg je o.a. gratis onbeperkt toegang tot 50 top musea + tot 50% korting op dagjes en avondjes uit). Je speelt mee zolang je zelf wilt.
privacy
 
 
gratis product Gratis 14 dagen Onbeperkt Boeken Luisteren
gratis producten
Luister bij Storytel met je mobiel 14 dagen onbeperkt naar luisterboeken. Keuze uit maarliefst 50.000+ boeken (bijvoorbeeld van Esther Verhoef, Suzanne Vermeer, Nicci French, Simone van der Vlugt, Harry Potter, Game of Thrones, etc.). Dit proefabonnement is tot wederopzegging en altijd opzegbaar. Dit doe je door op de accountpagina op de knop 'Abonnement beëindigen' te klikken. Indien je voor het einde van je proefperiode je abonnement opzegt, wordt er geen geld afgeschreven.
privacy
 
 
gratis product Gratis Daten bij HappyPancake (nr 1 in Zweden en Finland!)
gratis producten
HappyPancake is nu ook beschikbaar in Nederland! Dit is de best bezochte gratis datingsite in Zweden en Finland. 100% gratis zonder verborgen kosten. Er is een speciaal team dat alle profielen op echtheid controleert.
privacy
 
 
gratis product Gratis toegang van Abbemuseum Eindhoven
gratis producten
Het van Abbemuseum in Eindhoven is elke dinsdagmiddag tussen 15.00 en 17.00 uur gratis toegankelijk. Het museum heeft een uitgebreide internationale collectie van ruim 3.000 kunstwerken, waaronder sleutelwerken van Lissitzky, Picasso, Kokoschka, Chagall, Beuys, McCarthy, Daniëls en Körmeling.
privacy
 
 
gratis product Gratis proefpakketje Libresse Ultra Goodnight
gratis producten
Vraag een gratis proefpakketje aan van Libresse Ultra Goodnight extra maandverband. Vergeet niet om het vakje aan te klikken onder de afbeelding van het product.
privacy
 
 
gratis product Maak kans op een Nokia Activity Tracker t.w.v. € 189,95
gratis producten
Ontvang een vrijblijvend aanbod van ENGIE en maak kans op een Nokia Activity Tracker t.w.v. € 189,95.
privacy
 
 
gratis product Gratis nummer Radar+ Magazine
gratis producten
Vergelijk vrijblijvend 23 energieaanbieders van Nederland met elkaar en ontvang sowieso een gratis e-nummer van Radar+.
privacy
 
 
gratis product Gratis Sport High Protein Recovery Bar
gratis producten
Weer beschikbaar! De Vifit Sport High Protein Recovery Bar geeft je spieren ondersteuning na het sporten. Probeer gratis een van de 3 smaken: Lemon Yoghurt, Cranberry & Peach Yoghurt. Mededeling: Ververs de pagina of probeer een andere browser als er staat dat de samples op zijn. Eventueel kan je de volgende link kopiëren en plakken: https://www.vifitsport.com/nl/probeer-gratis/aanvragen
privacy
 
 
gratis product Gratis proefverpakking Nikwax BaseWash
gratis producten
Nikwax BaseWash reinigt effectief en verwijdert bacteriën en transpiratie uit de synthetische base layers. Beantwoord 5 vragen en ontvang een gratis proefverpakking met 50ml geconcentreerd Nikwax BaseWash. Je mag zo vaak meedoen als je wilt (hoewel je slechts 1x per 2 maanden een gratis product kan winnen).
privacy
 
 
gratis product Gratis Spreekbeurtpakket KNRM
gratis producten
Iedereen die een spreekbeurt wilt houden over de Koninklijke Nederlandse Redding Maatschappij kan een gratis spreekbeurtpakket aanvragen. Dit pakket bevat prachtige posters en het boekje "Redders op woest water".
privacy
 
 
gratis product Gratis magazine Roompot Vakanties
gratis producten
Het gloednieuwe magazine van Roompot Vakanties is uit. Naast leuke vakantiebestemmingen ook ervaringen van gasten, reportages en allerlei tips en ideeën voor zowel jezelf als voor de kids. Alleen inschrijven voor de nieuwsbrief kan ook. Je ontvangt dan de beste aanbiedingen en last minutes.
privacy
 
 
gratis product Gratis sample A. Vogel Keeltabletten
gratis producten
Vraag een gratis sample aan van A. Vogel Keeltabletten. Deze suikervrije zuigtabletten verzachten de keel en stimuleren het immuunsysteem. Mededeling: Als je 00000 ziet staan, tik of klik in de adresbalk op het internetadres en druk op 'enter' (of probeer een andere browser/computer).
privacy
 
 
Pagina 3 van 15   1  2  3  4  5  6  7  8  9  10  volgende >
    VEELGESTELDE VRAGENSTUUR EEN TIP INCONTACT
    COPYRIGHT © 2000 - 2018 • SITEMAPRSSLINKSPRIVACYDISCLAIMER

    rss bestand