logo

De nieuwste gratis producten en spullen

gratis product Binnenkort: Black Friday & Cyber Monday
gratis producten
Vrijdag 24 november is het weer Black Friday & Cyber Monday in Amerika (met absurde kortingen in de winkels). In Nederland doen nu steeds meer winkels mee met Black Friday / Cyber Monday. Wij gaan de beste acties verzamelen op Allesvoorniks, houdt onze site dus in de gaten vrijdag!
privacy
 
 
gratis product Gratis parfumsample Lancôme La Vie est Belle
gratis producten
Lever deze waardebon uiterlijk 3 december in bij Douglas en ontvang een gratis parfumsample van Lancôme La Vie est Belle.
privacy
 
 
gratis product Gratis Philips Hue pakket t.w.v. € 149,- cadeau
korting
Het zijn de Voor de Wind Weken bij ENGIE. Kies voor Windenergie en ontvang gratis een Philips Hue startpakket t.w.v. € 149,- cadeau. Voor iedere nieuwe klant plant ENGIE bomen en met de speciale app heb je real-time inzicht in jouw verbruik.
privacy
 
 
gratis product Gratis Schoen zetten bij LIDL
gratis producten
Vanaf 18 november kan je een knutselschoentje halen in de LIDL-winkels (of downloaden). Zet deze in elkaar, lever hem voor 5 december in en ontvang een verrassing van de Sint.
privacy
 
 
gratis product Gratis Diner Jaarkaart t.w.v. € 45,-
bijna gratis
Koop 1 van de 6 actieproducten (die ook nog eens in de aanbieding zijn) en ontvang een gratis Diner Jaarkaart t.w.v. € 45,-. Je hebt al een actieproduct voor € 8,99. De actieproducten zijn: Finish Powerball All-in-1 Vaatwastabletten, Veet Sensitive Precision Beauty Styler, Vanish Oxi Action, Vanisch Oxi Action White, Scholl Voetenvijl. Vanaf € 25,- wordt de bestelling gratis thuisbezorgd.
Ook een goede actie: 1+1 gratis op dekbedovertrekken.
privacy
 
 
gratis product Gratis VSM Derma Wondgel
gratis producten
Schrijf je in voor de VSM nieuwsbrief en ontvang een gratis VSM Derma Wondgel. Deze wondgel kan je gebruiken bij kleine snij-, schaaf- en brandwonden.
privacy
 
 
gratis product Win jouw eigen Verlanglijstje bij Intertoys t.w.v. € 449,-
winnen
Het nieuwe Intertoys Speelboek is uit. Met meer dan 1.200 ideeën voor op je verlanglijstje. Er staan ook leuke doe-opdrachten in het Speelboek. Maak jouw eigen verlanglijstje en maak kans om alle 10 de cadeautjes op dit lijstje te winnen. De maximale waarde die je kunt winnen is € 449,-. Elke week is er één winnaar, in totaal zijn er 10 prijswinnaars.
privacy
 
 
gratis product Gratis LEGO Waardebon t.w.v. € 10,-
bijna gratis
Bol.com heeft een leuk LEGO spel waarbij je een waardebon t.w.v. € 10,- kan verdienen (te besteden aan LEGO en DUPLO vanaf € 10,-, je hebt al LEGO vanaf € 10,79 en DUPLO vanaf € 10,19). Het is de bedoeling dat je stickers verzamelt. Zorg ervoor dat je 2 uur op het platform bent geweest én een van de LEGO-pagina's heb bezocht, dan unlock je namelijk de gouden verrassing/waardebon. Dit wordt dan onderaan je stickerpagina zichtbaar (daarna krijg je de waardebon binnen enkele dagen per mail toegestuurd).
privacy
 
 
gratis product Gratis Zonnebril
gratis producten
In de folder van Xooon staat de wincode fall17 verstopt. Als je deze invult bij het inschrijfformulier maak je kans op een wooncheque t.w.v. € 1.500,-. Bovendien ontvang je direct een waardebon per e-mail waarmee je een gratis zonnebril kunt afhalen bij een winkel van Xooon.
privacy
 
 
gratis product Gratis leuke Verrassing + Kans op Robotstofzuiger t.w.v. € 399,-
gratis producten
Passen jij en ENGIE bij elkaar? Ontdek het zelf! Doe de test en ontvang gratis een leuke verrassing! Bovendien maak je ook kans op de Neato Botvac D3 Robotstofzuiger.
privacy
 
 
gratis product Gratis Suprise Dozen + Handleiding
gratis producten
Bij ALDI kan je gratis dozen + handleiding ophalen om er zelf een surprise van te maken. Maak in 9 simpele stappen een Sinterklaas of het paard Amerigo.
privacy
 
 
gratis product Gratis Smartphone Autosticker
gratis producten
Laat zien dat jij je in het verkeer niet laat afleiden door jouw smartphone. Vraag de gratis autosticker bij ZLM aan.
privacy
 
 
gratis product Gratis Kleenex Origineel Mini uitproberen (500x)
winnen
Probeer gratis nieuwe producten uit en verdien geld met enquêtes bij het vernieuwde Toluna. Nu kunnen 500 deelnemers gratis Kleenex Origineel Mini uitproberen uitproberen. Binnenkort kan je ook L'Oreal Glanzende Glam Shine (520x) uitproberen. Nadat je bent aangemeld klik je rechtsboven op 'Ontdek' en daarna op 'Testproducten'. Maandelijks maak je ook nog eens kans op 5.000,-.
privacy
 
 
gratis product Maak een ander blij met je oude speelgoed
gratis producten
Bij een deelnemende Albert Heijn kan je een gratis Goedzak ophalen (ook bij je online boodschappen). Vul de Goedzak met speelgoed waarmee je een kind blij denkt te kunnen maken. De Goedzak komt dan terecht bij een lokaal goed doel. Je krijgt de Goedzak ook bij een online bestelling. Gratis bezorgen of ophalen bij diverse producten.
privacy
 
 
gratis product Maak kans op één jaar lang gratis opslag (5x) + Gratis 1 maand opslag
winnen
ALLSAFE Mini Opslag zoekt testers voor 1 jaar gratis opslagruimte zodat ze met jouw feedback de services kunnen verbeteren. Meld je aan om kans te maken op één jaar lang gratis opslag (5x). Als je tot één van de testers behoort, nemen ze op 8 december via e-mail contact met je op. Na deelname kan je een waardebon downloaden voor 1 maand gratis opslag.
privacy
 
 
gratis product Geld Terug Actie: Vifit Drinkyoghurt of Goedemorgen
geld terug actie
Probeer gratis Vifit Drinkyoghurt (multipack 4 x 250 ml) of Goedemorgen (multipack 4 x 250 ml). Koop in de winkel een multipack en bewaar de kassabon. Log in of maak makkelijk een account aan om de actiecodes die op de verpakking staan in te voeren. Binnen 14 werkdagen ontvang je het aankoopbedrag op je rekening.
privacy
 
 
gratis product Gratis Sport High Protein Recovery Bar
gratis producten
Weer beschikbaar! De Vifit Sport High Protein Recovery Bar geeft je spieren ondersteuning na het sporten. Probeer gratis een van de 3 smaken: Lemon Yoghurt, Cranberry & Peach Yoghurt. Mededeling: Ververs de pagina of probeer een andere browser als er staat dat de samples op zijn. Eventueel kan je deze link proberen of de volgende link kopiëren en plakken: https://www.vifitsport.com/nl/probeer-gratis/aanvragen
privacy
 
 
gratis product Gratis Bourjous Happy lichte Concealer uitproberen
winnen
Probeer gratis nieuwe producten uit en verdien geld met enquêtes bij het vernieuwde Toluna. Nu kunnen 540 deelnemers gratis Bourjous Happy lichte Concealer uitproberen uitproberen. Binnenkort kan je ook Kleenex Origineel Mini (500x) uitproberen. Nadat je bent aangemeld klik je rechtsboven op 'Ontdek' en daarna op 'Testproducten'. Maandelijks maak je ook nog eens kans op 5.000,-.
privacy
 
 
gratis product Gratis HEMA Cadeaukaart t.w.v. € 20,- of € 40,- bij Autoverzekering
korting
Met een HEMA Autoverzekering profiteer je van lage premies en ben je verzekerd van een prima dekking. Bereken snel en makkelijk je premie online. Bij het afsluiten/overstappen van een WA + Beperkt Casco of WA + Volledig Casco HEMA Autoverzekering krijg je nu een gratis HEMA Cadeaukaart t.w.v. € 25,- of € 40,-.
privacy
 
 
gratis product Gratis Bruna Cadeaukaart t.w.v. € 2,50 bij pakketje versturen
gratis producten
Verstuur je postpakket via PostNL bij Bruna en ontvang een Bruna Cadeaukaart t.w.v. € 2,50. Deze cadeaukaart is te besteden t/m 31 oktober 2018. Omdat de scholen weer zijn begonnen krijg je nu 50% korting op geselecteerde A-merk schoolspullen. Vanaf 20 euro wordt je bestelling gratis thuisbezorgd.
privacy
 
 
gratis product Gratis Goodiebag Pronto Wonen
gratis producten
Op woensdag 22 november is het Woonparty bij Pronto Wonen (25-jarig jubileum). Vanaf 19.00 is de winkel geopend, met hapje en drankje. Meld je aan voor deze avond en ontvang tijdens de Woonparty een gratis goodiebag. Deelnemende Pronto Woonwinkels: Alkmaar, Almere, Amsterdam (Villa Arena), Apeldoorn, Barneveld, Breda, Capelle a/d IJssel, Cruquius, Den Bosch, Eindhoven (Son), Elburg, Emmen, Gouda, Groningen, Heerlen, Helmond, Huissen, Meppel (Rogat), Middelburg, Nijmegen, Naaldwijk, Roermond, Sliedrecht, Soest, Spijkenisse, Terborg, Tilburg, Uden, Utrecht, Volendam, Wervershoof, Zoeterwoude & Zutphen.
privacy
 
 
gratis product Gratis proefnummer (vernieuwde) Eva Magazine t.w.v. € 4,50
gratis producten
Eva Magazine is vernieuwd. Nu met nog meer ruimte voor eerlijke en kwetsbare verhalen, diepte-interviews, achtergronden en natuurlijk lekker veel lifestyle en fashion. Verder bijzondere en inspirerende artikelen over allerlei onderwerpen die vrouwen bezighouden, zoals geloofs- en levensvragen, maar ook rubrieken over mode, verzorging, koken, natuur en uitgaan. Vraag een gratis proefnummer aan.
privacy
 
 
gratis product 70% korting op Outdoormerken (o.a. Falke)
korting
Word gratis lid van Outdoor Exclusive en profiteer van verrassende exclusieve en onverslaanbare acties. De beste outdoormerken voor minder dan de helft van de prijs (tot 70% korting). T/m 7 november: Garmin GPS Horloge Fenix 3 HR Sapphire voor maar € 329,-, Falke 70% korting, Regatta 70% korting, Dare 2B 70% korting, Leatherman 40% korting, Sorel 55% korting en Millet 55% korting.
privacy
 
 
gratis product Gratis Star Wars Magazine t.w.v. € 4,95
gratis producten
Reserveer je eigen Star Wars Magazine t.w.v. € 4,95 en haal deze vanaf 11 november op bij Primera. Het magazine bevat 80 pagina's met alles wat je moet weten over de nieuwste Star Wars-film. Er zijn 100.000 magazines beschikbaar.
privacy
 
 
gratis product Gratis zakje Fisherman's Friend Mint
gratis producten
Weer beschikbaar: Kies 3 vrienden en laat ze gratis een zakje Fisherman's Friend Mint aanvragen. Daarna kan je zelf een zakje aanvragen. Er zijn 10.000 zakjes beschikbaar. Mededeling: De actie werkt mogelijk niet via een mobiel of tablet, gebruik in dat geval een laptop of vaste computer.
privacy
 
 
Pagina 1 van 19   1  2  3  4  5  6  7  8  9  10  volgende >
    VEELGESTELDE VRAGENSTUUR EEN TIP INCONTACT
    COPYRIGHT © 2000 - 2017 • SITEMAPRSSLINKSPRIVACYDISCLAIMER

    rss bestand