logo

De nieuwste gratis producten en spullen

gratis product Gratis toegang van Abbemuseum Eindhoven
gratis producten
Het van Abbemuseum in Eindhoven is elke dinsdagmiddag tussen 15.00 en 17.00 uur gratis toegankelijk. Het museum heeft een uitgebreide internationale collectie van ruim 3.000 kunstwerken, waaronder sleutelwerken van Lissitzky, Picasso, Kokoschka, Chagall, Beuys, McCarthy, Daniëls en Körmeling.
privacy
 
 
gratis product Korting bij Kiosk (€0,25) en bij Starbucks (€0,30)
korting
Bij Starbucks en NS Kiosk krijg je korting als je je eigen koffiemok meeneemt. Wist je dat de korting die je krijgt eigenlijk de verwijderingsbijdrage is die je niet hoeft te betalen.
privacy
 
 
gratis product Gratis proefpakketje Libresse Ultra Goodnight
gratis producten
Vraag een gratis proefpakketje aan van Libresse Ultra Goodnight extra maandverband. Vergeet niet om het vakje aan te klikken onder de afbeelding van het product.
privacy
 
 
gratis product Gratis parfumsample Paco Rabanne Olympéa Aqua of Invictus Aqua
gratis producten
Lever de bon uiterlijk 11 maart in bij Douglas en ontvang een gratis sample van Paco Rabanne Olympéa Aqua (vrouw) of Invictus Aqua (man).
privacy
 
 
gratis product Dit weekend 20% Extra Korting bij Wehkamp + Opruiming tot 87%
korting
T/m zondag krijg je 20% extra korting op artikelen in de sale bij Wehkamp (dames-, heren-, kinder- en sportkleding). Je krijgt nu al tot 87% korting op artikelen in de sale, daar gaat dan nog eens 20% korting extra er vanaf. Sorteer de artikelen bijvoorbeeld op 'Hoogste korting'. In het linkermenu kan je diverse categorieën selecteren: Damesmode / Herenmode / Kinderen / Baby / Sport & Vrije Tijd / Wonen & Slapen / Tuin & Klussen / Huishouden / Speelgoed. Je betaalt alleen verzendkosten als je besluit artikelen te houden. Retourneren is gratis. De verzending vanaf € 20,- gratis.
privacy
 
 
gratis product Gratis Dierentuin Knutselvel + Gratis 2e Dierentuinkaartje
gratis producten
Maak je eigen dierentuin(kijkdoos) met het gratis knutselvel. Dit knutselvel kan je downloaden of ophalen bij een winkel van Intertoys. T/m 18 maart ontvang je bij besteding van minimaal 10 euro een voucher voor een gratis 2e kaartje op een geselecteerd aantal dierenparken (+ kans op midweek of weekend voor 6 personen naar Safaripark Beekse Bergen). Winteractie: Je krijgt nu ook tot 70% korting op heel veel winterspeelgoed!
privacy
 
 
gratis product Gratis MobiMax brochure
gratis producten
Ontdek in de gratis MobiMax brochure de voordelen van een scootmobiel en welke scootmobiel bij jou past.
privacy
 
 
gratis product Maak kans op een Nokia Activity Tracker t.w.v. € 189,95
gratis producten
Ontvang een vrijblijvend aanbod van ENGIE en maak kans op een Nokia Activity Tracker t.w.v. € 189,95.
privacy
 
 
gratis product Gratis NYX Turnt Up Lipstick uitproberen (300x)
winnen
Probeer gratis nieuwe producten uit en verdien geld met enquêtes bij het vernieuwde Toluna. Nu kunnen 300 deelnemers gratis NYX Turnt Up Lipstic uitproberen. Binnenkort kan je ook Maybelline Dream Blender (310x) en Colgate ZigZag Toothbrush (180x) uitproberen. Nadat je bent aangemeld klik je rechtsboven op 'Ontdek' en daarna op 'Testproducten'. Maandelijks maak je ook nog eens kans op 5.000,-.
privacy
 
 
gratis product Gratis nummer Radar+ Magazine
gratis producten
Vergelijk vrijblijvend 23 energieaanbieders van Nederland met elkaar en ontvang sowieso een gratis e-nummer van Radar+.
privacy
 
 
gratis product Gratis Abrazi Armband t.w.v. 89,- bij TrosKompas voor 34,75
bijna gratis
Je krijgt nu een gratis Abrazi Armband t.w.v. € 89,- bij een TrosKompas TV-Magazine abonnement van een jaar. In totaal betaal je € 34,75 voor het eerste jaar (het eerste half jaar is gratis en voor het tweede half jaar betaal je € 34,75). Je bent tot wederopzegging lid en opzeggen kan eenvoudig per e-mail (abonneeservice@troskompas.nl).
privacy
 
 
gratis product Gratis Sport High Protein Recovery Bar
gratis producten
Weer beschikbaar! De Vifit Sport High Protein Recovery Bar geeft je spieren ondersteuning na het sporten. Probeer gratis een van de 3 smaken: Lemon Yoghurt, Cranberry & Peach Yoghurt. Mededeling: Ververs de pagina of probeer een andere browser als er staat dat de samples op zijn. Eventueel kan je de volgende link kopiëren en plakken: https://www.vifitsport.com/nl/probeer-gratis/aanvragen
privacy
 
 
gratis product Gratis proefverpakking Nikwax BaseWash
gratis producten
Nikwax BaseWash reinigt effectief en verwijdert bacteriën en transpiratie uit de synthetische base layers. Beantwoord 5 vragen en ontvang een gratis proefverpakking met 50ml geconcentreerd Nikwax BaseWash. Je mag zo vaak meedoen als je wilt (hoewel je slechts 1x per 2 maanden een gratis product kan winnen).
privacy
 
 
gratis product Gratis Spreekbeurtpakket KNRM
gratis producten
Iedereen die een spreekbeurt wilt houden over de Koninklijke Nederlandse Redding Maatschappij kan een gratis spreekbeurtpakket aanvragen. Dit pakket bevat prachtige posters en het boekje "Redders op woest water".
privacy
 
 
gratis product Gratis PC Game Dead Space
gratis producten
Bij Origin kan je nu tijdelijk Dead Space voor PC downloaden. In deze actie/shooter speel jij Isaac Clarke, een ingenieur op het ruimteschip USG Ishimura. Het is niet bekend hoe lang de actie duurt. Klik op 'toevoegen aan gamebibliotheek'.
privacy
 
 
gratis product Gratis L'Oréal Paris Elvive Fijne Kokosolie 2-in-1 Haarmasker
gratis producten
Weer beschikbaar: Vraag via Facebook een gratis sample aan van het nieuwe L'Oréal Paris Elvive Fijne Kokosolie 2-in-1 Haarmasker (voor onder de douche). Dit haarmasker zorgt voor intensieve voeding en makkelijke ontwarring, zonder te verzwaren.
privacy
 
 
gratis product Gratis magazine Roompot Vakanties
gratis producten
Het gloednieuwe magazine van Roompot Vakanties is uit. Naast leuke vakantiebestemmingen ook ervaringen van gasten, reportages en allerlei tips en ideeën voor zowel jezelf als voor de kids. Alleen inschrijven voor de nieuwsbrief kan ook. Je ontvangt dan de beste aanbiedingen en last minutes.
privacy
 
 
gratis product Efteling Actie bij Albert Heijn + Gratis Producten + Gratis Bezorging
korting
Spaar bij Albert heijn voor 10,- korting op een Efteling kaartje. T/m 25 februari krijg je een zegel bij elke 5 euro aan boodschappen, bij 4 zegels is de spaarkaart vol. Je krijgt ook diverse gratis producten bij je online bestelling. Nieuwe klanten kunnen nog tot eind februari gebruik maken van de kortingscode PFJAN1801 voor een maand lang gratis bezorging. Bestaande klanten krijgen gratis bezorging bij een select aantal producten.
privacy
 
 
gratis product Gratis € 7,50 PayPal voor korting bij iBood
gratis producten
Bij PayPal ontvang je 7,50 die je kunt besteden bij iBood. Met dat tegoed kan je een gratis Simson Bandenplakset t.w.v. 6,95 bestellen (inclusief verzending). Kies bij betaalmethode voor PayPal om het gratis tegoed te gebruiken. Je kan het tegoed ook als korting voor een van de vele andere producten gebruiken.
privacy
 
 
gratis product Maak kans € 250,- Shoptegoed (3x)
winnen
Op welke temperatuur zet jij de verwarming? Geef jouw temperatuur aan op de thermometer en maak kans op één van de drie 50five.nl shoptegoedbonnen t.w.v. € 250,-.
privacy
 
 
gratis product Gratis 2 HEMA Tompouces
gratis producten
Tag op Facebook iemand met wie je graag een tompouce wilt eten en vul het formulier in om op 1 maart een voucher van KNAB te ontvangen. Met deze voucher kan je 2 gratis tompouces ophalen bij HEMA (tot 18 maart). Het aantal vouchers heeft een limiet, dus op=op. Tip: Mocht je op je mobiel geen venster krijgen om je gegevens in te vullen, gebruik dan een pc/laptop en klik op 'Registreren'.
privacy
 
 
gratis product Maak kans op een GAMMA Cadeaupas t.w.v. € 50,-
winnen
Beantwoord de vraag 'Zet jij je weleens in als vrijwilliger?' en maak kans op een GAMMA cadeaupas t.w.v. € 50,- (50x). Met de cadeaupas kan jij je eigen pakket samenstellen t.w.v. € 50,-. Bijvoorbeeld: bouwmaterialen, gereedschap, tuin, verf, verlichting, woondecoratie, etc.
privacy
 
 
gratis product Gratis Spontex All Purpose Cloth (370x)
winnen
Probeer gratis nieuwe producten uit en verdien geld met enquêtes bij het vernieuwde Toluna. Nu kunnen 370 deelnemers gratis Spontex All Purpose Cloth uitproberen. Binnenkort kan je ook NYX Turnt Up Lipstick (300x) uitproberen. Nadat je bent aangemeld klik je rechtsboven op 'Ontdek' en daarna op 'Testproducten'. Maandelijks maak je ook nog eens kans op 5.000,-.
privacy
 
 
gratis product Gratis 10 nummers FiscAlert (met handige info over Belastingaangifte)
gratis producten
Vanaf 1 maart 2018 moet je weer de belastingaangifte doen over 2017. Ontvang 10 nummers van FiscAlert (met zeer handige tips en informatie over bijvoorbeeld de Belastingaangifte, Prinsjesdag, hypotheken, pensioen, sparen, beleggen, Bitcoins, etc.). Het mooie is dat je na afloop zelf bepaalt wat jou de 10 nummers waard zijn geweest, na afloop ontvang je namelijk een blanco acceptgiro.
privacy
 
 
gratis product Gratis sample A. Vogel Keeltabletten
gratis producten
Vraag een gratis sample aan van A. Vogel Keeltabletten. Deze suikervrije zuigtabletten verzachten de keel en stimuleren het immuunsysteem. Mededeling: Als je 00000 ziet staan, tik of klik in de adresbalk op het internetadres en druk op 'enter' (of probeer een andere browser/computer).
privacy
 
 
Pagina 1 van 20   1  2  3  4  5  6  7  8  9  10  volgende >
    VEELGESTELDE VRAGENSTUUR EEN TIP INCONTACT
    COPYRIGHT © 2000 - 2018 • SITEMAPRSSLINKSPRIVACYDISCLAIMER

    rss bestand