logo

De nieuwste gratis producten en spullen

gratis product Gratis nummer Radar+ Magazine
gratis producten
Vergelijk vrijblijvend 23 energieaanbieders van Nederland met elkaar en ontvang sowieso een gratis e-nummer van Radar+.
privacy
 
 
gratis product Gratis Bicycling Magazine t.w.v. € 5,95
gratis producten
Ontvang gratis het Bicycling Magazine t.w.v. € 5,95 (nr 1 2018). In dit magazine wordt de mens op de fiets centraal gesteld. Met bijzondere verhalen van gewone mensen en ongewone verhalen van bijzondere mensen.
privacy
 
 
gratis product Gratis Abrazi Armband t.w.v. € 89,- bij TrosKompas voor € 9,99
bijna gratis
Ontvang een half jaar TrosKompas TV-Magazine voor slechts € 9,99 en krijg een Abrazi Armband t.w.v. € 89,-. Dit abonnement is tot wederopzegging (maand opzegtermijn). Opzeggen kan eenvoudig door een mail te sturen naar abonneeservice@troskompas.nl
privacy
 
 
gratis product Gratis Sport High Protein Recovery Bar
gratis producten
Weer beschikbaar! De Vifit Sport High Protein Recovery Bar geeft je spieren ondersteuning na het sporten. Probeer gratis een van de 3 smaken: Lemon Yoghurt, Cranberry & Peach Yoghurt. Mededeling: Ververs de pagina of probeer een andere browser als er staat dat de samples op zijn. Eventueel kan je de volgende link kopiëren en plakken: https://www.vifitsport.com/nl/probeer-gratis/aanvragen
privacy
 
 
gratis product Gratis proefverpakking Nikwax BaseWash
gratis producten
Nikwax BaseWash reinigt effectief en verwijdert bacteriën en transpiratie uit de synthetische base layers. Beantwoord 5 vragen en ontvang een gratis proefverpakking met 50ml geconcentreerd Nikwax BaseWash. Je mag zo vaak meedoen als je wilt (hoewel je slechts 1x per 2 maanden een gratis product kan winnen).
privacy
 
 
gratis product Gratis Spreekbeurtpakket KNRM
gratis producten
Iedereen die een spreekbeurt wilt houden over de Koninklijke Nederlandse Redding Maatschappij kan een gratis spreekbeurtpakket aanvragen. Dit pakket bevat prachtige posters en het boekje "Redders op woest water".
privacy
 
 
gratis product Gratis PC Game Dead Space
gratis producten
Bij Origin kan je nu tijdelijk Dead Space voor PC downloaden. In deze actie/shooter speel jij Isaac Clarke, een ingenieur op het ruimteschip USG Ishimura. Het is niet bekend hoe lang de actie duurt. Klik op 'toevoegen aan gamebibliotheek'.
privacy
 
 
gratis product Gratis L'Oréal Paris Elvive Fijne Kokosolie 2-in-1 Haarmasker
gratis producten
Weer beschikbaar: Vraag via Facebook een gratis sample aan van het nieuwe L'Oréal Paris Elvive Fijne Kokosolie 2-in-1 Haarmasker (voor onder de douche). Dit haarmasker zorgt voor intensieve voeding en makkelijke ontwarring, zonder te verzwaren.
privacy
 
 
gratis product Gratis magazine Roompot Vakanties
gratis producten
Het gloednieuwe magazine van Roompot Vakanties is uit. Naast leuke vakantiebestemmingen ook ervaringen van gasten, reportages en allerlei tips en ideeën voor zowel jezelf als voor de kids. Alleen inschrijven voor de nieuwsbrief kan ook. Je ontvangt dan de beste aanbiedingen en last minutes.
privacy
 
 
gratis product Efteling Actie bij Albert Heijn + Gratis Producten + Gratis Bezorging
korting
Spaar bij Albert heijn voor 10,- korting op een Efteling kaartje. T/m 25 februari krijg je een zegel bij elke 5 euro aan boodschappen, bij 4 zegels is de spaarkaart vol. Je krijgt ook diverse gratis producten bij je online bestelling. Nieuwe klanten kunnen nog tot eind februari gebruik maken van de kortingscode PFJAN1801 voor een maand lang gratis bezorging. Bestaande klanten krijgen gratis bezorging bij een select aantal producten.
privacy
 
 
gratis product Gratis € 7,50 PayPal voor korting bij iBood
gratis producten
Bij PayPal ontvang je 7,50 die je kunt besteden bij iBood. Met dat tegoed kan je een gratis Simson Bandenplakset t.w.v. 6,95 bestellen (inclusief verzending). Kies bij betaalmethode voor PayPal om het gratis tegoed te gebruiken. Je kan het tegoed ook als korting voor een van de vele andere producten gebruiken.
privacy
 
 
gratis product Maak kans € 250,- Shoptegoed (3x)
winnen
Op welke temperatuur zet jij de verwarming? Geef jouw temperatuur aan op de thermometer en maak kans op één van de drie 50five.nl shoptegoedbonnen t.w.v. € 250,-.
privacy
 
 
gratis product Gratis 2 HEMA Tompouces
gratis producten
Tag op Facebook iemand met wie je graag een tompouce wilt eten en vul het formulier in om op 1 maart een voucher van KNAB te ontvangen. Met deze voucher kan je 2 gratis tompouces ophalen bij HEMA (tot 18 maart). Het aantal vouchers heeft een limiet, dus op=op. Tip: Mocht je op je mobiel geen venster krijgen om je gegevens in te vullen, gebruik dan een pc/laptop en klik op 'Registreren'.
privacy
 
 
gratis product Maak kans op een GAMMA Cadeaupas t.w.v. € 50,-
winnen
Beantwoord de vraag 'Zet jij je weleens in als vrijwilliger?' en maak kans op een GAMMA cadeaupas t.w.v. € 50,- (50x). Met de cadeaupas kan jij je eigen pakket samenstellen t.w.v. € 50,-. Bijvoorbeeld: bouwmaterialen, gereedschap, tuin, verf, verlichting, woondecoratie, etc.
privacy
 
 
gratis product Gratis Spontex All Purpose Cloth (370x)
winnen
Probeer gratis nieuwe producten uit en verdien geld met enquêtes bij het vernieuwde Toluna. Nu kunnen 370 deelnemers gratis Spontex All Purpose Cloth uitproberen. Binnenkort kan je ook NYX Turnt Up Lipstick (300x) uitproberen. Nadat je bent aangemeld klik je rechtsboven op 'Ontdek' en daarna op 'Testproducten'. Maandelijks maak je ook nog eens kans op 5.000,-.
privacy
 
 
gratis product Gratis 10 nummers FiscAlert (met handige info over Belastingaangifte)
gratis producten
Vanaf 1 maart 2018 moet je weer de belastingaangifte doen over 2017. Ontvang 10 nummers van FiscAlert (met zeer handige tips en informatie over bijvoorbeeld de Belastingaangifte, Prinsjesdag, hypotheken, pensioen, sparen, beleggen, Bitcoins, etc.). Het mooie is dat je na afloop zelf bepaalt wat jou de 10 nummers waard zijn geweest, na afloop ontvang je namelijk een blanco acceptgiro.
privacy
 
 
gratis product Gratis sample A. Vogel Keeltabletten
gratis producten
Vraag een gratis sample aan van A. Vogel Keeltabletten. Deze suikervrije zuigtabletten verzachten de keel en stimuleren het immuunsysteem. Mededeling: Als je 00000 ziet staan, tik of klik in de adresbalk op het internetadres en druk op 'enter' (of probeer een andere browser/computer).
privacy
 
 
gratis product Gratis Daten bij HappyPancake (nr 1 in Zweden en Finland!)
gratis producten
HappyPancake is nu ook beschikbaar in Nederland! Dit is de best bezochte gratis datingsite in Zweden en Finland. 100% gratis zonder verborgen kosten. Er is een speciaal team dat alle profielen op echtheid controleert.
privacy
 
 
gratis product Tot 3 cent extra tankkorting bij Shell, BP, Esso, Total, Q8, Gulf, Texaco
korting
Tank je regelmatig bij Shell, BP, Esso, Total, Q8, Gulf of Texaco? Laat de tankkaart van United Consumer zien bij een van de ruim 600 tankstations en ontvang per liter brandstof tot 3ct korting. Bovendien is er nu een leuke actie: Deelnemers die vóór 01-04-2018 minimaal 25 liter tanken bij een van de aangesloten tankstations, maken kans op een gratis tankbeurt t.w.v. € 60,-. Indien je de kaart NIET gebruikt betaal je een bijdrage van € 5,- voor de verzendkosten (250liter in 6 maanden).
privacy
 
 
gratis product Gratis 3 maanden 500 Mbit/s internet uitproberen + TV + Ziggo Sport
korting
Probeer het beste (zakelijke) internet 3 maanden op proef (+ gratis installatie). Gewoon naast je huidige provider, geheel vrijblijvend. Zodat je het echt goed kunt vergelijken. Je kan er ook TV (dus ook Ziggo Sport met live Formule 1) en Telefonie bij nemen. Je mag in deze 3 maanden altijd zonder opgave van reden opzeggen. De actie is geldig voor nieuwe klanten van Ziggo. Als particuliere klant van Ziggo zónder internet mag je ook gebruik maken van deze actie (bij bedrijfsnaam je naam invullen, KVK-nummer en BTW-nummer leeg laten).
privacy
 
 
gratis product Gratis Feyenoord Kameraadjes-lidmaatschap (o.a. Welkomstpakket, Bezoek wedstrijd, Magazine, Rondleiding door De Kuip en meer)
gratis producten
Op woensdag 14 februari is het precies negen maanden na 14 mei 2017, de dag dat Feyenoord kampioen van Nederland werd. Dit zou zomaar kunnen leiden tot een geboortegolf van Kampioensbaby's :) Baby's geboren op 14 februari 2018 krijgen een gratis Kameraadjes-lidmaatschap voor de volledige looptijd van veertien jaar. Baby's die zijn geboren tussen 7 februari 2018 en 21 februari 2018 (met uitzondering van 14 februari 2018) krijgen tot het einde van seizoen 2017-2018 het Kameraadjes-lidmaatschap gratis.
privacy
 
 
gratis product Gratis Evenement: Landelijke Sterrenkijkdagen
gratis producten
Op 23, 24 en 25 februari zijn het de Landelijke Sterrenkijkdagen. Overal in het land vinden activiteiten plaats die de sterrenkunde dicht bij de mensen brengt. Bekijk de lijst met 'Kijkadressen' om te zien of de toegang gratis is.
privacy
 
 
gratis product Maak kans op € 200,- Shoptegoed bij Douglas
winnen
Meld je aan voor de nieuwsbrief van Douglas en maak kans op € 200,- shoptegoed (te besteden in de winkel of online). Door je aan te melden voor nieuwsbrief blijf je op de hoogte van de laatste trends op beautygebied, nieuwste producten en handige tips&tricks. Vergeet niet om de aanmelding te bevestigen, via de bevestigingslink die je per e-mail ontvangt.
privacy
 
 
gratis product Gratis 2 entreekaarten avondopening Negenmaandenbeurs / Huishoudbeurs t.w.v. € 11,50 p.s.
gratis producten
Met de Kruidvat Jouw Extravoordeelkaart kan je gratis 2 toegangskaarten aanvragen voor de avondopening van de Negenmaandenbeurs op donderdag 22 of vrijdag 23 februari tussen 17.00 en 22.00. Deze kaarten zijn ook geldig voor de huishoudbeurs. Als je nog geen Kruidvat Jouw Extravoordeelkaart hebt, kan je deze gratis ophalen bij een winkel van Kruidvat. Wil je op een andere dag gaan of overdag? Koop dan je kaarten voor de Negenmaandenbeurs met € 3,55 korting (21 t/m 25 februari) of Huishoudbeurs met € 3,55 korting (17 t/m 25 februari). Met een kaartje kan je beide beurzen bezoeken.
privacy
 
 
gratis product Gratis sample Yves Saint Laurent Touche Éclat Le Teint
gratis producten
Tegen inlevering van deze waardebon bij Douglas ontvang je een sample van Yves Saint Laurent Touche Éclat Le Teint. Er is ook nog een andere waardebon voor een gratis sample van Yves Saint Laurent Black Opium Glow, Black Opium, L'Homme of L'Homme Ultime. Inleveren kan t/m 28 februari.
privacy
 
 
Pagina 1 van 20   1  2  3  4  5  6  7  8  9  10  volgende >
    VEELGESTELDE VRAGENSTUUR EEN TIP INCONTACT
    COPYRIGHT © 2000 - 2018 • SITEMAPRSSLINKSPRIVACYDISCLAIMER

    rss bestand