logo

De nieuwste gratis producten en spullen

gratis product Niet Goed Geld Terug: 2 flessen Listerine (actieverpakking)
geld terug actie
Koop 2 flessen Listerine met het actielabel "Ervaar het verschil in 21 dagen" en ga de 21-dagen challenge aan. Na de 21-dagen challenge is het tandplak afgenomen. Indien je niet tevreden bent kan je (na 21 dagen) het aankoopbedrag terug vragen.
privacy
 
 
gratis product Gratis Daten bij HappyPancake (nr 1 in Zweden en Finland!)
gratis producten
HappyPancake is nu ook beschikbaar in Nederland! Dit is de best bezochte gratis datingsite in Zweden en Finland. 100% gratis zonder verborgen kosten. Er is een speciaal team dat alle profielen op echtheid controleert.
privacy
 
 
gratis product Gratis toegang van Abbemuseum Eindhoven
gratis producten
Het van Abbemuseum in Eindhoven is elke dinsdagmiddag tussen 15.00 en 17.00 uur gratis toegankelijk. Het museum heeft een uitgebreide internationale collectie van ruim 3.000 kunstwerken, waaronder sleutelwerken van Lissitzky, Picasso, Kokoschka, Chagall, Beuys, McCarthy, Daniëls en Körmeling.
privacy
 
 
gratis product Korting bij Kiosk (€0,25) en bij Starbucks (€0,30)
korting
Bij Starbucks en NS Kiosk krijg je korting als je je eigen koffiemok meeneemt. Wist je dat de korting die je krijgt eigenlijk de verwijderingsbijdrage is die je niet hoeft te betalen.
privacy
 
 
gratis product Gratis proefpakketje Libresse Ultra Goodnight
gratis producten
Vraag een gratis proefpakketje aan van Libresse Ultra Goodnight extra maandverband. Vergeet niet om het vakje aan te klikken onder de afbeelding van het product.
privacy
 
 
gratis product Maak kans op een Nokia Activity Tracker t.w.v. € 189,95
gratis producten
Ontvang een vrijblijvend aanbod van ENGIE en maak kans op een Nokia Activity Tracker t.w.v. € 189,95.
privacy
 
 
gratis product Gratis nummer Radar+ Magazine
gratis producten
Vergelijk vrijblijvend 23 energieaanbieders van Nederland met elkaar en ontvang sowieso een gratis e-nummer van Radar+.
privacy
 
 
gratis product Gratis Abrazi Armband t.w.v. 89,- bij TrosKompas voor 34,75
bijna gratis
Je krijgt nu een gratis Abrazi Armband t.w.v. € 89,- bij een TrosKompas TV-Magazine abonnement van een jaar. In totaal betaal je € 34,75 voor het eerste jaar (het eerste half jaar is gratis en voor het tweede half jaar betaal je € 34,75). Je bent tot wederopzegging lid en opzeggen kan eenvoudig per e-mail (abonneeservice@troskompas.nl).
privacy
 
 
gratis product Gratis Sport High Protein Recovery Bar
gratis producten
Weer beschikbaar! De Vifit Sport High Protein Recovery Bar geeft je spieren ondersteuning na het sporten. Probeer gratis een van de 3 smaken: Lemon Yoghurt, Cranberry & Peach Yoghurt. Mededeling: Ververs de pagina of probeer een andere browser als er staat dat de samples op zijn. Eventueel kan je de volgende link kopiëren en plakken: https://www.vifitsport.com/nl/probeer-gratis/aanvragen
privacy
 
 
gratis product Gratis proefverpakking Nikwax BaseWash
gratis producten
Nikwax BaseWash reinigt effectief en verwijdert bacteriën en transpiratie uit de synthetische base layers. Beantwoord 5 vragen en ontvang een gratis proefverpakking met 50ml geconcentreerd Nikwax BaseWash. Je mag zo vaak meedoen als je wilt (hoewel je slechts 1x per 2 maanden een gratis product kan winnen).
privacy
 
 
gratis product Gratis Spreekbeurtpakket KNRM
gratis producten
Iedereen die een spreekbeurt wilt houden over de Koninklijke Nederlandse Redding Maatschappij kan een gratis spreekbeurtpakket aanvragen. Dit pakket bevat prachtige posters en het boekje "Redders op woest water".
privacy
 
 
gratis product Gratis magazine Roompot Vakanties
gratis producten
Het gloednieuwe magazine van Roompot Vakanties is uit. Naast leuke vakantiebestemmingen ook ervaringen van gasten, reportages en allerlei tips en ideeën voor zowel jezelf als voor de kids. Alleen inschrijven voor de nieuwsbrief kan ook. Je ontvangt dan de beste aanbiedingen en last minutes.
privacy
 
 
gratis product Gratis sample A. Vogel Keeltabletten
gratis producten
Vraag een gratis sample aan van A. Vogel Keeltabletten. Deze suikervrije zuigtabletten verzachten de keel en stimuleren het immuunsysteem. Mededeling: Als je 00000 ziet staan, tik of klik in de adresbalk op het internetadres en druk op 'enter' (of probeer een andere browser/computer).
privacy
 
 
gratis product Gratis 3 maanden 500 Mbit/s internet uitproberen + TV + Ziggo Sport
korting
Probeer het beste (zakelijke) internet 3 maanden op proef (+ gratis installatie). Gewoon naast je huidige provider, geheel vrijblijvend. Zodat je het echt goed kunt vergelijken. Je kan er ook TV (dus ook Ziggo Sport met live Formule 1) en Telefonie bij nemen. Je mag in deze 3 maanden altijd zonder opgave van reden opzeggen. De actie is geldig voor nieuwe klanten van Ziggo. Als particuliere klant van Ziggo zónder internet mag je ook gebruik maken van deze actie (bij bedrijfsnaam je naam invullen, KVK-nummer en BTW-nummer leeg laten).
privacy
 
 
gratis product Gratis eBooks (100+)
gratis producten
Bij Bol.com kan je gratis eBooks krijgen die je op jouw computer, tablet, mobiel of e-reader kunt lezen. Het lezen van eBooks op je tablet/mobiel kan eenvoudig met de speciale Bol.com Kobo eBook app. Het lezen op de computer kan door Adobe Digital Editions te gebruiken.
privacy
 
 
gratis product Maak kans op 1 jaar lang gratis De Telegraaf
winnen
"De gaskraan in Groningen moet volledig dicht". Ben je het hier mee eens of oneens? Laat weten wat jij vindt van deze stelling en maak kans op 1 jaar lang gratis De Telegraaf.
privacy
 
 
gratis product Gratis Faith Magazine + 4 Wenskaarten
gratis producten
Faith is een glossy over huwelijk, liefde en trouw. Het magazine bevat achtergrondverhalen en interviews, met onder anderen Tooske en Bastiaan Ragas van het EO-programma 'Zo zijn we niet getrouwd'. Met achtergrondverhalen over communicatiestijlen (inclusief testje), ruziepatronen, de verschillende fases van het huwelijk en wat geluk eigenlijk precies is. Er zitten ook 4 wenskaarten bij.
privacy
 
 
gratis product Bespaar € 550,- per jaar op de energierekening
gratis producten
Ontvang vrijblijvend advies over het isoleren van jouw huis. Zo bespaar je al gauw € 550,- per jaar op de energierekening. Naast een hoger wooncomfort, wordt de woning meer waard en krijg je een beter energielabel.
privacy
 
 
gratis product Gratis LEGO Waardebon t.w.v. € 10,-
bijna gratis
Bol.com heeft een leuk LEGO spel waarbij je een waardebon t.w.v. € 10,- kan verdienen (te besteden aan LEGO en DUPLO vanaf € 10,-, je hebt al LEGO vanaf € 10,79 en DUPLO vanaf € 10,19). Het is de bedoeling dat je stickers verzamelt. Zorg ervoor dat je 2 uur op het platform bent geweest én een van de LEGO-pagina's heb bezocht, dan unlock je namelijk de gouden verrassing/waardebon. Dit wordt dan onderaan je stickerpagina zichtbaar (daarna krijg je de waardebon binnen enkele dagen per mail toegestuurd).
privacy
 
 
gratis product Gratis rondleiding Yakult fabriek + Goodiebag
gratis producten
Yakult heeft data gereserveerd voor een rondleiding in de fabriek in Almere. Je wordt verwelkomd met koffie of thee, er is een presentatie over Yakult, proeverij met productieprocesrondleiding en een gratis goodiebag.
privacy
 
 
gratis product Win één jaar Gratis Boodschappen t.w.v. € 3.000,-
winnen
Doe mee met het Vava lifestyle-onderzoek naar de levensstijl van Nederlandse huishoudens. Als je het onderzoek volledig afrondt (ongeveer 10 minuten), maak je kans op 1 jaar lang gratis boodschappen, ter waarde van € 3.000,- (vrij besteedbaar). Je kan gerust meedoen, je ontvangt namelijk geen spam/reclame via e-mail of vervelende telefoontjes.
privacy
 
 
gratis product Gratis Becel ProActiv Starterskit + 1 Gratis Becel ProActiv Product
gratis producten
De gratis Becel ProActiv Starterskit geeft informatie over cholesterol en hoe je deze kunt verlagen. Met snelle en makkelijke tips om meer te bewegen. Voedingstips en lekkere, verantwoorde recepten. Er zit ook een geld-terug-bon in voor een gratis Becel ProActiv product naar keuze + 3 kortingsbonnen.
privacy
 
 
gratis product Gratis doorgang Westerscheldetunnel
gratis producten
In 2018 zijn er weer zes tolvrije dagen gepland voor de Westerscheldetunnel. De tunnel is tolvrij op de volgende data: 27 januari, 24 februari, 14 april, 8 september, 27 oktober en 24 november. Je kan dan op deze dag van 00.00 tot 24.00 uur in beide richtingen door de tunnel rijden zonder tol te betalen. Afhankelijk van het voertuig scheelt dit € 5,- tot € 25,-.
privacy
 
 
gratis product Gratis het vernieuwde Grando Inspiratie Magazine
gratis producten
Vraag gratis het vernieuwde Grando Inspiratie Magazine aan. Met 76 pagina's vol inspiratie, advies en praktische tips voor jouw zoektocht naar een nieuwe keuken en/of badkamer. Binnen 3 werkdagen thuisbezorgd.
privacy
 
 
gratis product Gratis BoekStartkoffertje + Gratis Lidmaatschap Bibliotheek
gratis producten
Deze actie is voor baby's van ongeveer 3 maanden. Download deze waardebon (PDF-bestand) om een gratis BoekStartkoffertje op te halen in een deelnemende Bibliotheek. Het BoekStartkoffertje bevat 2 babyboekjes, een boekenlegger en een folder over voorlezen. Je kindje krijgt ook meteen een gratis lidmaatschap voor de bibliotheek zodat je gratis de leukste babyboekjes kan lenen.
privacy
 
 
Pagina 4 van 19   1  2  3  4  5  6  7  8  9  10  volgende >
    VEELGESTELDE VRAGENSTUUR EEN TIP INCONTACT
    COPYRIGHT © 2000 - 2018 • SITEMAPRSSLINKSPRIVACYDISCLAIMER

    rss bestand